HORDB

General Information

ID: hor006095
Uniprot ID: O96690
Protein name: Neuropeptide PDF
Gene name: Pdf
Organism: Drosophila melanogaster (Fruit fly)
Family: Arthropod PDH family
Source: Animal
Expression: Expressed at constant level, without strong circadian variations. Its amount nevertheless oscillates along day and night cycles in the termini of dorsally projected axons of LNvs. |Predominantly expressed in adult head. Expressed at higher level in males
Disease: NA
Comments: NA
Taxonomy: melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007617 mating behavior; GO:0007623 circadian rhythm; GO:0008062 eclosion rhythm; GO:0009416 response to light stimulus; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0042332 gravitaxis; GO:0042745 circadian sleep/wake cycle; GO:0042749 regulation of circadian sleep/wake cycle; GO:0043153 entrainment of circadian clock by photoperiod; GO:0045475 locomotor rhythm; GO:0048511 rhythmic process; GO:1901562 response to paraquat; GO:1904059 regulation of locomotor rhythm
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043005 neuron projection; GO:0043025 neuronal cell body

Sequence Information

Sequence: NSELINSLLSLPKNMNDA
Length: 18(83-100)
Propeptide: MARYTYLVALVLLAICCQWGYCGAMAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLGPSVPIRKRNSELINSLLSLPKNMNDAGK
Signal peptide: MARYTYLVALVLLAICCQWGYCGA
Modification: T18 Alanine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Neuropeptide PDF is the main transmitter regulating circadian locomotor rhythms. Required to maintain behavioral rhythms under constant conditions by coordinating pacemaker interactions in the circadian system. Ectopic expression induces long periods, whi
Mechanism: NA
Cross BBB: NA
Target: Pdfr
Target Unid: Q9W4Y2
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-O96690-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006095_AF2.pdb

hor006095_ESM.pdb

Physical Information

Mass:	227664	Formula:	C83H141N23O30S
Absent amino acids:	CFGHQRTVWY	Common amino acids:	LN
pI:	4.18	Basic residues:	1
Polar residues:	7	Hydrophobic residues:	6
Hydrophobicity:	-30.56	Boman Index:	-2908
Half-Life / Aliphatic Index:	1.4 hour	Aliphatic Index:	113.89
Instability Index:	2984.44	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

Literature

PubMed ID: 9615286
Title: Isolation and chronobiological analysis of a neuropeptide pigment-dispersing factor gene in Drosophila melanogaster.
PubMed ID: 10731132
Title: The genome sequence of Drosophila melanogaster.
PubMed ID: 12537572
Title: Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
PubMed ID: 12537569
Title: A Dr
PubMed ID: 21214272
Title:
PubMed ID: 10619432
Title:
PubMed ID: 10725392
Title:
PubMed ID: 10777797
Title:
PubMed ID: 15356209
Title:
PubMed ID: 19038223
Title:
PubMed ID: 19230663
Title: